PAL-GHK Peptide
Sequence (Three-Letter Code): Palmitoyl-Gly-His-Lys Molecular formula: C30H54N6O5 Molecular weight: 578.8 g/mol What Is Pal-GHK? PAL-GHK is also known as palmitoyl tripeptide-1 and is a small copper-binding peptide made up of three…
IGF-1 LR3 Introduction:
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…
Epithalon Peptide
What is Epithalon ? Epitalon is a synthetic peptide made of four amino acids (alanine, glutamic acid, aspartic acid, and glycine),in additon,that is based on a natural peptide called Epithalamin…
Cyclic Peptides Overview
Cyclic peptides are polypeptides that contain a cyclization- like sequence of connections.This can be achieved by linking the amino and carboxyl ends of peptides, as in cyclosporine; The connection between…
Vital Proteins and collagen peptides
Proteins are large biomolecules,or macromolecules,consisting of one or more long chains of amino acid residues.Proteins perform a vast array of functions within organisms,including catalysing metabolic reactions,DNA replication, responding to stimuli,providing…
Peptide Repair Function
Peptide, biologically, is a compound consisting of two or more amino acids linked in a chain, the carboxyl group of each acid being joined to the amino group of the…
Peptides for Dogs
Collagen is the major structural protein found in your dog’s body. It’s what makes up your pet’s skin and connective tissues including its joints, tendons, ligaments, and cartilage. A dog’s…
What are peptides?
Peptides are naturally occurring biological molecules. Peptides are found in all living organisms and play a key role in all manner of biological activity. Like proteins, peptides are formed (synthesized) naturally…
Collagen peptides side effect
What is Collagen ? Collagen is the most abundant protein in your body, found in skin, muscles, tendons, bones, ligaments, and even teeth, blood vessels, and corneas. Collagen has many…
Bioactive peptides
Consumers' awareness of the health promoting effects of functional food and nutritional health products is the driving force of the functional food and nutritional health products…
