polypeptide

A polypeptide is a polymer with a definite sequence of amino acids held together by covalent peptide bonds.The peptide bond is the result of a condensation reaction between two amino acids: the carboxyl of one amino acid reacts with the amino of its neighbor, releasing a molecule of water (H2O).Short chains of amino acids connected by peptide bonds are called peptides.Peptides usually consist of as many as 20-30 amino acids.Amino acid residues with long chain connections of specific sequences are called polypeptides.Polypeptides can contain up to 4,000 residues.Polypeptides are characterized by a polypeptide skeleton composed of repeated atomic sequences at the core of the linked amino acid chain.The R group of the specific side chain of amino acid is connected with the main polypeptide chain.Peptides can be folded into fixed structures that form proteins.Thus, peptides form linear sequences of amino acid residues forming the primary structure of proteins.

Buy peptide: Bpc-157

What is BPC-157? BPC-157:Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val.Molecular Formula: C62H98N16O22Molecular Weight: 1419.556 g/molInChI Key: HEEWEZGQMLZMFE-DGQLYNSISA-NChemical Names: Bpc 15; Bpc 157; Booly protection compound 15; Bpc-157; BPC-15; UNII-8ED8NXK95PBPC 157 (body protection compound -157) is…

Continue Reading

Where to buy BPC-157 ?

What is BPC-157? BPC-157: Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Molecular Formula: C62H98N16O22 Molecular Weight: 1419.556 g/mol InChI Key: HEEWEZGQMLZMFE-DGQLYNSISA-N Chemical Names: Bpc 15; Bpc 157; Booly protection compound 15; Bpc-157; BPC-15; UNII-8ED8NXK95P BPC…

Continue Reading

IGF-1 LR3 Introduction:

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…

Continue Reading

Peptides VS Proteins

Peptides and proteins are natural and essential organic compounds in cells.They're all made up of amino acids.Amino acids are naturally occurring compounds that join together to form peptides, polypeptides, and…

Continue Reading
Close Menu
Choose Your Lauguage »
×
×

Cart