Peptides have been identified that bind with high affinity to body surfaces, such as, hair, skin, nails, teeth, gums, and oral cavity surfaces. Diblock and triblock peptide-based body surface coloring reagents formed by coupling a body surface binding peptide to a pigment binding peptide, either directly or through a spacer, are described. The peptide-based body surface coloring reagents may be used in conjunction with pigments to color body surfaces. The invention relates to the field of personal care products. More specifically, the invention relates to diblock and triblock peptide-based body surface coloring reagents comprising body surface-binding peptides and pigment-binding peptides that may be used to attach pigments to body surfaces.

Buy GHRP-2

GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP), which acts on the hypothalamus and the pituitary gland to release growth hormone with…

Continue Reading

MT-2 peptide

Melanotan 2 (also referred to as Melanotan II) is a synthetically produced variant of a peptide hormone naturally produced in the body that stimulates melanogenesis, a process responsible for pigmentation of…

Continue Reading

Peptide GHRP-6

Peptide GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 Appearance: Sterile filtered white lyophilized (freeze-dried) powder What’s GHRP-6? GHRP-6, full name is Growth hormone-releasing peptide 6, we also…

Continue Reading

Triptorelin Buy

Triptorelin (GnRH) Triptorelin, also called GnRH. Triptorelin is a decapeptide that is occasionally known as Decapeptyl, Gonapeptyl, Diphereline, or Variopeptyl. Molecular Formula: C64H82N18O13 Molecular Mass: 1311.45 Sequence: pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2 Appearance: Lyophilized…

Continue Reading

PAL-GHK Peptide

Sequence (Three-Letter Code): Palmitoyl-Gly-His-Lys Molecular formula: C30H54N6O5 Molecular weight: 578.8 g/mol What Is Pal-GHK? PAL-GHK is also known as palmitoyl tripeptide-1 and is a small copper-binding peptide made up of three…

Continue Reading

IGF-1 LR3 Introduction:

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…

Continue Reading
  • 1
  • 2
Close Menu
Choose Your Lauguage »
×
×

Cart