Peptides have been identified that bind with high affinity to body surfaces, such as, hair, skin, nails, teeth, gums, and oral cavity surfaces. Diblock and triblock peptide-based body surface coloring reagents formed by coupling a body surface binding peptide to a pigment binding peptide, either directly or through a spacer, are described. The peptide-based body surface coloring reagents may be used in conjunction with pigments to color body surfaces. The invention relates to the field of personal care products. More specifically, the invention relates to diblock and triblock peptide-based body surface coloring reagents comprising body surface-binding peptides and pigment-binding peptides that may be used to attach pigments to body surfaces.

Peptide Sermorelin

------  a peptide analog of Growth Hormone-Releasing Hormone (GHRH) useful for diagnostic purposes and anti-aging treatment.Sermorelin (GRF 1-29) Description:Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2Molecular formula: C149H246N44O42S Source: Chemical SynthesisAppearance: White PowderMolar Mass: 3357.96CAS number: 86168-78-7PubChem: CID 16133753Solubility: >Soluble in water or 1% acetic acidSynonyms: Sermorelin acetate…

Continue Reading

Buy Triptorelin Peptide

Triptorelin also was known as Gonadotropin-releasing hormone (GnRH) is a synthetic peptide that elicits the release of Luteinizing Hormone (LH) and Follicle-Stimulating Hormone (FSH) as a biological response of the gonadotropin-releasing…

Continue Reading

PT-141 Peptide

PT-141 is a research peptide that carries a half-life of 120 minutes. It has a molecular formula of C50H68N14O10, and it has a molecular weight of 1025.2. Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH Molecular formula: C50H68N14O10 Molar…

Continue Reading

IGF-1 LR3 peptide for muscle

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: What is IGF-1 LR3? Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a…

Continue Reading
Close Menu
Choose Your Lauguage »
×
×

Cart