Peptides have been identified that bind with high affinity to body surfaces, such as, hair, skin, nails, teeth, gums, and oral cavity surfaces. Diblock and triblock peptide-based body surface coloring reagents formed by coupling a body surface binding peptide to a pigment binding peptide, either directly or through a spacer, are described. The peptide-based body surface coloring reagents may be used in conjunction with pigments to color body surfaces. The invention relates to the field of personal care products. More specifically, the invention relates to diblock and triblock peptide-based body surface coloring reagents comprising body surface-binding peptides and pigment-binding peptides that may be used to attach pigments to body surfaces.
PT-141 is a research peptide that carries a half-life of 120 minutes. It has a molecular formula of C50H68N14O10, and it has a molecular weight of 1025.2. Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH Molecular formula: C50H68N14O10 Molar…
Selank (Thr-Lys-Pro-Arg-Pro-Gly-Pro) is an anxiolytic peptide, the analogue of the immunomodulatory peptide tuftsin. It was developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. Due to its anxiolytic effect,…
BPC-157 (pentadecapeptide) is an injectable peptide developed for alleviating stomach ulcers. It is characterized by its ability to accelerate the healing of a huge variety of wounds such as skin, cornea, muscle,…
What Is GDF-8 Myostatin? Growth differentiation factor 8 (propeptide-Fc) is known to be a myostatin inhibitor of the process of muscle growth and development. Myostatin (GDF-8) is present in the…
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: What is IGF-1 LR3? Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a…
Selectively destroy the blood supply to adipose tissue by using a test drug, Obese macaques lost an average of 11% of their body weight in 4 weeks. Researchers at the…
What is MT-2? MT2 ( full named Melanotan 2 ) peptide is quite hot and popular around the world, nowadays people can be more easily to get it through the…
GHK-CU, (Copper Peptide) is a naturally occurring human tri-peptide. In plasma, the level of GHK-Cu is about 200 ng/ml at age 20. By the age of 60, the level drops to…
GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP), which acts on the hypothalamus and the pituitary gland to release growth hormone with…
Melanotan 2 (also referred to as Melanotan II) is a synthetically produced variant of a peptide hormone naturally produced in the body that stimulates melanogenesis, a process responsible for pigmentation of…
@2018 Giantlab.net All Rights Reserved