Peptides have been identified that bind with high affinity to body surfaces, such as, hair, skin, nails, teeth, gums, and oral cavity surfaces. Diblock and triblock peptide-based body surface coloring reagents formed by coupling a body surface binding peptide to a pigment binding peptide, either directly or through a spacer, are described. The peptide-based body surface coloring reagents may be used in conjunction with pigments to color body surfaces. The invention relates to the field of personal care products. More specifically, the invention relates to diblock and triblock peptide-based body surface coloring reagents comprising body surface-binding peptides and pigment-binding peptides that may be used to attach pigments to body surfaces.
Peptide GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 Appearance: Sterile filtered white lyophilized (freeze-dried) powder What’s GHRP-6? GHRP-6, full name is Growth hormone-releasing peptide 6, we also…
CAS Number: 49557-75-7 Chemical Formula: C14H24N6O4 Molar Mass: 340.38 g/mol What’s Copper peptide GHK-Cu? Copper peptide GHK-Cu is a naturally occurring copper complex of the tripeptide glycyl-L-histidyl-L-lysine. The tripeptide has…
Triptorelin (GnRH) Triptorelin, also called GnRH. Triptorelin is a decapeptide that is occasionally known as Decapeptyl, Gonapeptyl, Diphereline, or Variopeptyl. Molecular Formula: C64H82N18O13 Molecular Mass: 1311.45 Sequence: pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2 Appearance: Lyophilized…
Sequence (Three-Letter Code): Palmitoyl-Gly-His-Lys Molecular formula: C30H54N6O5 Molecular weight: 578.8 g/mol What Is Pal-GHK? PAL-GHK is also known as palmitoyl tripeptide-1 and is a small copper-binding peptide made up of three…
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…
Peptides are naturally occurring biological molecules. Peptides are found in all living organisms and play a key role in all manner of biological activity. Like proteins, peptides are formed (synthesized) naturally…
Peptide are widely used in various aspects and fields. Peptide applications may soon be as varied as peptides themselves. Indeed, cell-penetrating peptides (CPP) have served to deliver various molecules and particles…