Peptide bpc-157, with 15 amino acids, so apparently BPC-157 is peptide.

Amino acid is the most basic substance that constitutes a biological protein. It is the basic unit. It constitutes a protein molecule in a living organism and it has a very close relationship with the life activities of living things. Naturally, there are 20 kinds of amino acids present in proteins.

IGF-1 LR3 Introduction:

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…

Continue Reading

What are peptides?

Peptides are naturally occurring biological molecules. Peptides are found in all living organisms and play a key role in all manner of biological activity. Like proteins, peptides are formed (synthesized) naturally…

Continue Reading

Collagen Peptides

Collagen peptides is a transparent, light yellow collagen extract. It consists of two or more amino acids. The molecular weight of the peptide and the different amino acid arrangement order are different.…

Continue Reading

Peptide Definition

PeptidePeptides (from Greek language πεπτός, peptós "digested"; derived from πέσσειν, péssein "to digest") are short chains of amino acid monomers linked by peptide (amide) bonds.The covalent chemical bonds are formed…

Continue Reading

BPC-157 and TB-500

What is BPC-157 Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Molecular Formula: C62H98N16O22 Molecular Weight: 1419.556 g/mol InChI Key: HEEWEZGQMLZMFE-DGQLYNSISA-N Chemical Names: Bpc 15; Bpc 157; Booly protection compound 15; Bpc-157; BPC-15; UNII-8ED8NXK95P BPC 157…

Continue Reading
  • 1
  • 2
Close Menu
Choose Your Lauguage »
×
×

Cart