Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a Human Recombinant, single, non-glycosylated, polypeptide chain containing 83 amino acids. It is an analog of human IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arginine (Arg or R) for the Glutamic Acid (Glu or E) at position 3 (hence R3), and a 13 amino acid extension peptide at the N-terminus. IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development. IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3. The Long R3 IGF-1 version is significantly more potent than regular IGF-1.
![](https://giantlab.net/wp-content/uploads/2018/08/IGF-1LR3-1.jpg)
This analog has been engineered with the express purpose of increasing biological activity. IGF-1 Long[R3] is significantly more potent than IGF-1 in vitro and in vivo. The enhanced potency is due to the markedly decreased binding of IGF-1 Long[R3] to all IGF binding proteins. These binding proteins normally inhibit the biological actions of IGFs. IGF-1 stands for insulin-like growth factor. It is a natural substance that is produced in the human body and is at its highest natural levels during puberty. During puberty IGF-1 is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF-1 does in the human body. The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed ‘sulfation factor,’ which later became known as ‘somatomedin’. IGF-1 LR3 is the primary protein involved in responses of cells to growth hormone (GH): that is, IGF-I is produced in response to GH and then induces cellular activities. One such example is muscle growth or hyperplasia. This compound also makes the human body more sensitive to insulin. It is the most potent growth factor found in the human body. IGF-1 causes muscle cell hyperplasia, which is an actual splitting and forming of new muscle cells. The most effective form of IGF-1 is considered to be IGF-1 LR3. This formula has been chemically altered to avoid binding to proteins in the human body, and to increase the half life, approximately 20-30 hours.
IGF-1 LR3 is unlikely to cause the allergic reaction, and almost no side effects. It is for only a few individuals, if they appear.
IGF-1 LR3 peptide for muscle
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
The IGF-1 LR3 Structure:
What is IGF-1 LR3?
Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a Human Recombinant, single, non-glycosylated, polypeptide chain containing 83 amino acids. It is an analog of human IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arginine (Arg or R) for the Glutamic Acid (Glu or E) at position 3 (hence R3), and a 13 amino acid extension peptide at the N-terminus. IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development. IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3. The Long R3 IGF-1 version is significantly more potent than regular IGF-1.
This analog has been engineered with the express purpose of increasing biological activity. IGF-1 Long[R3] is significantly more potent than IGF-1 in vitro and in vivo. The enhanced potency is due to the markedly decreased binding of IGF-1 Long[R3] to all IGF binding proteins. These binding proteins normally inhibit the biological actions of IGFs. IGF-1 stands for insulin-like growth factor. It is a natural substance that is produced in the human body and is at its highest natural levels during puberty. During puberty IGF-1 is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF-1 does in the human body. The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed ‘sulfation factor,’ which later became known as ‘somatomedin’. IGF-1 LR3 is the primary protein involved in responses of cells to growth hormone (GH): that is, IGF-I is produced in response to GH and then induces cellular activities. One such example is muscle growth or hyperplasia. This compound also makes the human body more sensitive to insulin. It is the most potent growth factor found in the human body. IGF-1 causes muscle cell hyperplasia, which is an actual splitting and forming of new muscle cells. The most effective form of IGF-1 is considered to be IGF-1 LR3. This formula has been chemically altered to avoid binding to proteins in the human body, and to increase the half life, approximately 20-30 hours.
IGF-1 LR3 is unlikely to cause the allergic reaction, and almost no side effects. It is for only a few individuals, if they appear.
Buy IGF-1 LR3 1mg from Giant Lab Online Store —- Peptide USA Domestic Shipping
admin