Peptide is a naturally occurring small biomolecule, between amino acids and proteins.

Since the amino acid has the smallest molecule and the largest protein, they are short chains composed of amino acid monomers and are linked by peptide (amide) bonds. The covalent chemical bond is formed when a carboxyl group of one amino acid reacts with an amino group of another amino acid. The short chain of peptides consisting of amino acids is a precise protein fragment.

Buy GHRP-2

GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP), which acts on the hypothalamus and the pituitary gland to release growth hormone with…

Continue Reading

Triptorelin Peptide

Triptorelin also was known as Gonadotropin-releasing hormone (GnRH) is a synthetic peptide that elicits the release of Luteinizing Hormone (LH) and Follicle-Stimulating Hormone (FSH) as a biological response of the gonadotropin-releasing…

Continue Reading

GHK-CU:

   ------  Copper Peptide(GHK-CU) stimulate blood vessel and nerve outgrowth, but it also enhances the presence of collagen, glycosaminoglycan synthesis, and elastin within the body. Sequence: (Gly-His-Lys)2Cu.xHAc Molecular formula: C14H24N6O4  CAS…

Continue Reading

IGF-1 LR3 Introduction:

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…

Continue Reading

Collagen Peptides

Collagen peptides is a transparent, light yellow collagen extract. It consists of two or more amino acids. The molecular weight of the peptide and the different amino acid arrangement order are different.…

Continue Reading
  • 1
  • 2
Close Menu
Choose Your Lauguage »
×
×

Cart