Peptide is a naturally occurring small biomolecule, between amino acids and proteins.

Since the amino acid has the smallest molecule and the largest protein, they are short chains composed of amino acid monomers and are linked by peptide (amide) bonds. The covalent chemical bond is formed when a carboxyl group of one amino acid reacts with an amino group of another amino acid. The short chain of peptides consisting of amino acids is a precise protein fragment.

Ipamorelin Information:

Ipamorelin is a peptide agonist of the Ghrelin Hormone Secretagogue Receptor (GHSR), which significantly increases plasma growth hormone (GH) levels in humans. The pharmaceutical company Novo Nordisk originally developed this peptide, but…

Continue Reading

Buy IGF-1 DES 1mg

What is IGF-1 DES? IGF-1 DES is a peptide, simple of insulin-like development factor 1 accessible as a peptide. 1GF-1 DES is entirely different compared to other products because of its strength,…

Continue Reading

Buy Triptorelin Peptide

Triptorelin also was known as Gonadotropin-releasing hormone (GnRH) is a synthetic peptide that elicits the release of Luteinizing Hormone (LH) and Follicle-Stimulating Hormone (FSH) as a biological response of the gonadotropin-releasing…

Continue Reading

PT-141 Peptide

PT-141 is a research peptide that carries a half-life of 120 minutes. It has a molecular formula of C50H68N14O10, and it has a molecular weight of 1025.2. Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH Molecular formula: C50H68N14O10 Molar…

Continue Reading

IGF-1 LR3 peptide for muscle

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: What is IGF-1 LR3? Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a…

Continue Reading
Close Menu
Choose Your Lauguage »
×
×

Cart