Peptide is a naturally occurring small biomolecule, between amino acids and proteins.
Since the amino acid has the smallest molecule and the largest protein, they are short chains composed of amino acid monomers and are linked by peptide (amide) bonds. The covalent chemical bond is formed when a carboxyl group of one amino acid reacts with an amino group of another amino acid. The short chain of peptides consisting of amino acids is a precise protein fragment.
Ipamorelin is a peptide agonist of the Ghrelin Hormone Secretagogue Receptor (GHSR), which significantly increases plasma growth hormone (GH) levels in humans. The pharmaceutical company Novo Nordisk originally developed this peptide, but…
What is IGF-1 DES? IGF-1 DES is a peptide, simple of insulin-like development factor 1 accessible as a peptide. 1GF-1 DES is entirely different compared to other products because of its strength,…
It’s a synthetic version of Tβ4 (Thymosin Beta4). Thymosin is a protein encoded by the TMSB4X gene in humans. The protein consists of 43 amino acids, and it regulates actin…
Triptorelin also was known as Gonadotropin-releasing hormone (GnRH) is a synthetic peptide that elicits the release of Luteinizing Hormone (LH) and Follicle-Stimulating Hormone (FSH) as a biological response of the gonadotropin-releasing…
PT-141 is a research peptide that carries a half-life of 120 minutes. It has a molecular formula of C50H68N14O10, and it has a molecular weight of 1025.2. Sequence: Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH Molecular formula: C50H68N14O10 Molar…
Selank (Thr-Lys-Pro-Arg-Pro-Gly-Pro) is an anxiolytic peptide, the analogue of the immunomodulatory peptide tuftsin. It was developed by the Institute of Molecular Genetics of the Russian Academy of Sciences. Due to its anxiolytic effect,…
BPC-157 (pentadecapeptide) is an injectable peptide developed for alleviating stomach ulcers. It is characterized by its ability to accelerate the healing of a huge variety of wounds such as skin, cornea, muscle,…
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: What is IGF-1 LR3? Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a…
GHK-CU, (Copper Peptide) is a naturally occurring human tri-peptide. In plasma, the level of GHK-Cu is about 200 ng/ml at age 20. By the age of 60, the level drops to…
What is TB-500? TB-500, also named Thymosin Beta 4, is a peptide that naturally occurs in the human body and in animal bodies, and, since it is mostly sold for research…