Buy GHRP-2
GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP), which acts on the hypothalamus and the pituitary gland to release growth hormone with…
Peptide is a naturally occurring small biomolecule, between amino acids and proteins.
Since the amino acid has the smallest molecule and the largest protein, they are short chains composed of amino acid monomers and are linked by peptide (amide) bonds. The covalent chemical bond is formed when a carboxyl group of one amino acid reacts with an amino group of another amino acid. The short chain of peptides consisting of amino acids is a precise protein fragment.
Where to buy peptides for bodybuilding
Observation reveals that peptides have become more and more popular in recent years among bodybuilders and those coveting a great body. This trend, perhaps, is influenced by relative difficulty in…
Best place to buy TB-500
What is TB-500? TB-500 is a synthetic natural peptide found in almost all human and animal cells, thymosin-4.It has been studied in many clinical trials. Studies have shown that if a…
Triptorelin Peptide
Triptorelin also was known as Gonadotropin-releasing hormone (GnRH) is a synthetic peptide that elicits the release of Luteinizing Hormone (LH) and Follicle-Stimulating Hormone (FSH) as a biological response of the gonadotropin-releasing…
TB-500 effects
It’s a synthetic version of Tβ4 (Thymosin Beta4). Thymosin is a protein encoded by the TMSB4X gene in humans. The protein consists of 43 amino acids, and it regulates actin…
GHK-CU：
------ Copper Peptide(GHK-CU) stimulate blood vessel and nerve outgrowth, but it also enhances the presence of collagen, glycosaminoglycan synthesis, and elastin within the body. Sequence: (Gly-His-Lys)2Cu.xHAc Molecular formula: C14H24N6O4 CAS…
IGF-1 LR3 Introduction:
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…
Collagen Peptides
Collagen peptides is a transparent, light yellow collagen extract. It consists of two or more amino acids. The molecular weight of the peptide and the different amino acid arrangement order are different.…
Are proteins also peptides？
Peptide: Peptide is a compound in which α-amino acids are linked together by peptide bonds, and it is also an intermediate product of protein hydrolysis. Generally, the number of amino acids…
Peptide before and after:
There has been a great deal of discussion and controversy in the media around the use of peptides. The interesting thing about this is that most people who ask for…
