Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a Human Recombinant, single, non-glycosylated, polypeptide chain containing 83 amino acids.

IGF-1 LR3 peptide for muscle

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: What is IGF-1 LR3? Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a…

Continue Reading

IGF-1 LR3 For Sale

AMINO ACID SEQUENCE MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Structure: SYNONYMS R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1. INTRODUCTION IGF-1 (insulin-like…

Continue Reading

IGF-1 LR3 Introduction:

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: Buy IGF-1 LR3 1mg from Giant Lab Online Store ---- Peptide USA Domestic Shipping:…

Continue Reading
Close Menu
Choose Your Lauguage »
×
×

Cart