CJC-1295 Cycle
What is CJC-1295? Mod GRF 1-29 is a peptide hormone that, signals the release of endogenously manufactured Human Growth Hormone from the pituitary gland as opposed to administering exogenous synthetic…
Peptide BPC-157 for sale
BPC-157 (pentadecapeptide) is an injectable peptide developed for alleviating stomach ulcers. It is characterized by its ability to accelerate the healing of a huge variety of wounds such as skin, cornea, muscle,…
Buy GHRP-6 online
What is GHRP-6? GHRP-6, full named growth hormone releasing peptide 6, is a synthetic compound made of six amino acids. GHRP-6 is one of the more potent stimulators of Natural…
Peptides For Sale- Hexarelin Review
What is Hexarelin? Hexarelin is a synthetic growth hormone secretagogue. It is derived from GHRP-6 and has a similar effect as ghrelin. As shown in the animal research model, the main…
Epitalon peptide for sale
CAS No.:307297-39-8 Synonyms:Epitalon;Epithalone,Epithalamin (known as Epialon,Epithalone,Epithalamin) Molecular Formula:C14H22N4O9 Molecular Weight:390.349 g/mol Clinical Studies with Epithalon (epitalon) Epitalon is a synthetic peptide made of four amino acids (alanine, glutamic acid, aspartic acid,…
GHRP-6 5mg peptide for sale
GHRP-6, full named growth hormone releasing peptide 6, is a synthetic compound made of six amino acids. GHRP-6 is one of the more potent stimulators of Natural Growth Hormone Release…
Myostatin peptide for sale
What Is GDF-8 Myostatin? Growth differentiation factor 8 (propeptide-Fc) is known to be a myostatin inhibitor of the process of muscle growth and development. Myostatin (GDF-8) is present in the…
IGF-1 LR3 peptide for muscle
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 9,111 Da Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1 The IGF-1 LR3 Structure: What is IGF-1 LR3? Long[R3] insulin-like growth factor-I (IGF-1 Long[R3] ) is a…
Best place to buy BPC-157
What is BPC-157 ? BPC-157 is a pentadecapeptide found in human gastric juice, it has a composition of 15 amino acids: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Va. BPC-157 is a protein booster which was initially made…
HGH Fragment 176-191 Review – Peptides For Sale
HGH Fragment 176-191 review: Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Frag 176-191 5mg…
